Protein Info for PFR28_02093 in Pseudomonas sp. RS175

Annotation: Vitamin B12 transport ATP-binding protein BacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 24 to 292 (269 residues), 161.1 bits, see alignment E=5.5e-51 PF05992: SbmA_BacA" amino acids 30 to 342 (313 residues), 118.3 bits, see alignment E=7.7e-38 PF00005: ABC_tran" amino acids 376 to 508 (133 residues), 55.2 bits, see alignment E=1.9e-18

Best Hits

KEGG orthology group: None (inferred from 88% identity to pba:PSEBR_a2386)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (567 amino acids)

>PFR28_02093 Vitamin B12 transport ATP-binding protein BacA (Pseudomonas sp. RS175)
MHTLRNFWRLARPFWASEEKYPALLLLAATVLMTLCLVGVNILTNFWNLHFYNALQALDY
PGFLVGSVQFILLQVGTAAFTVGAFHFQQKLTLRWRRWATRNMLDQWLGAQRYQKLKLTE
TEVDNPDQRIAEDIDLFIVKSLKLSLGLLTSVVSLFSFLHILWQASSLVSIPFAGDAVVV
PGLLVWIALVYALLGTGLAFWLGRALPGLNFMQQRREADFRFSLIRLRENADSVAQYRGE
AVENQRFNQRLEAALENFWALVKKQKLIMGYSTFYLRSATVIPMFIMAPQFFSGAFPLGR
LTQISAAFGEVHAAIAYLVGVFPELSEWKSVIDRLVGFQERLDNVQVKSKVTLGRQAKGL
HIKDLDVWLPNGRRLLKGFNLSLEPGDSLLISAPSGYGKSTLIRTVTGLWHHACGSSSYD
RERALTLSQKPYLPLGSLREALWYPNPPRPEEEVNLRLAMEQVGLQHLGEQLDEDRDWAQ
TLSIGEQQRCAFVRALMARPAVLFLDESSSALDAENEARCYQMLRQALPETIMISVGHNA
SLERFHWQVLELQSEAQWACRKVKQAV