Protein Info for PFR28_02033 in Pseudomonas sp. RS175

Annotation: Blue-light photoreceptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 TIGR00229: PAS domain S-box protein" amino acids 5 to 128 (124 residues), 81 bits, see alignment E=3.9e-27 PF13188: PAS_8" amino acids 6 to 60 (55 residues), 30.4 bits, see alignment E=6.9e-11 PF00989: PAS" amino acids 7 to 119 (113 residues), 50.5 bits, see alignment E=4.9e-17 PF08448: PAS_4" amino acids 11 to 122 (112 residues), 34.6 bits, see alignment E=5.1e-12 PF13426: PAS_9" amino acids 16 to 121 (106 residues), 76.4 bits, see alignment E=4.7e-25 PF08447: PAS_3" amino acids 31 to 115 (85 residues), 39.1 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: None (inferred from 89% identity to ppf:Pput_3014)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>PFR28_02033 Blue-light photoreceptor (Pseudomonas sp. RS175)
MIDAKLLQLMVEHSNDGIVVAEQEGHESILIYTNPAFERLTGYSADDILYQDCRFLQGQD
HDQAGIATIRQAIRERRPCRQVLRNYRKDGSLFWNELSITPVHNEADQLTYYIGIQRDVT
AQISAEEKVRELEAEVAELRRQLDAVKR