Protein Info for PFR28_01991 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 813 transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 300 to 317 (18 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 375 to 401 (27 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details amino acids 640 to 656 (17 residues), see Phobius details amino acids 663 to 685 (23 residues), see Phobius details amino acids 692 to 715 (24 residues), see Phobius details amino acids 727 to 754 (28 residues), see Phobius details amino acids 765 to 790 (26 residues), see Phobius details PF03176: MMPL" amino acids 212 to 426 (215 residues), 20.8 bits, see alignment E=8.5e-09 amino acids 493 to 789 (297 residues), 46.1 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 84% identity to pba:PSEBR_a2685)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (813 amino acids)

>PFR28_01991 hypothetical protein (Pseudomonas sp. RS175)
MNDHNPALEQQVVTARLEDFDPRSGNLGERAIFNHRPWVILLCLLATLVLGYQASKIGLN
ASFEKTIPTSHPYVAHFLEQRSELSGLGNSIRIAVEVKDGSIFDKDYLDTLARLNDEIYL
LPGVDKPYMKSLWTPTTRWTAVTEEGLDGGTVIPDSYDGSPASLDEVRTNVARSGEIGQL
VAANFQSSVIFVPLLEINPATGKALDAGEFSRQLEALRDKYQSARIQIHITGFTKIIGDL
IAGLTQVLLFFVVAVLVTVAVLYWYTRCARSTALVVLCSLVAVLWQIGLLASLGYDLDPY
SALVPFLVFAIGMSHGAQKMNGIMQDIGRGTHRVIAARYTFRRLFAAGMTALLCDAVGFA
VLIVIKIQVIQDLAITASIGVAVLIFTNLILLPILLSYVGVGAKAAARSLRTETAELAAS
VRHPFWRFLDLFTQRSWACAACLVGLALAVGGFAVSLQLKVGDLDPGAPELRPDSRYNRD
AAFMTQNYAASSDIFVVMVKTPEDQCTRYPTLAAVDSLAWQLEQLPGVESTNSMAALSKI
AAAGYNEGNFKWYELIPNEGALGAVQTRAPRELFNQGCSLLSLYVYLADHKADTLQRVVE
TSEAFIARQQLPDVKFMLAAGSAGIEAATNIVVKKAMREMLFWVYGAVVLLCWVTFRSWR
AVLAAVLPLVLTSILCEALMVGLGMGVKVATLPVIALGVGIGVDYALYVLSIILVHMRAG
ASLSEAYYRALLFTGKVVLLTGITLAIAVATWAWSPIKFQADMGILLAFMFLVNMLGALI
LLPALAYFLLPQRLFAKKPEPSGALQPIGEGGN