Protein Info for PFR28_01980 in Pseudomonas sp. RS175

Annotation: Disulfide-bond oxidoreductase YghU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF02798: GST_N" amino acids 45 to 127 (83 residues), 32.4 bits, see alignment E=2e-11 PF13410: GST_C_2" amino acids 176 to 244 (69 residues), 43.4 bits, see alignment E=5.8e-15 PF14497: GST_C_3" amino acids 180 to 252 (73 residues), 23.6 bits, see alignment E=1e-08 PF00043: GST_C" amino acids 182 to 250 (69 residues), 32.5 bits, see alignment E=1.7e-11

Best Hits

Swiss-Prot: 72% identical to YGHU_ECOLI: Disulfide-bond oxidoreductase YghU (yghU) from Escherichia coli (strain K12)

KEGG orthology group: K11209, GST-like protein (inferred from 91% identity to pba:PSEBR_a2431)

MetaCyc: 72% identical to disulfide reductase / organic hydroperoxide reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6256

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>PFR28_01980 Disulfide-bond oxidoreductase YghU (Pseudomonas sp. RS175)
MNETSYIPPKVWTHEAPSGGHFANINRPVAGPTHEKTLPVGKHPLQLYSLATPNGVKVTI
LLEELLALGHTGAEYDAWLIRINEGDQFSSGFVQINPNSKIPALLDRSVEPSIRVFESGS
ILLYLAQKFSAFLPTDLAGRTETLNWLFWQMGSAPYLGGGFGHFYAYAPEKLEYPINRFT
MEAKRQLDVLDRRLAESRYLAGNDYTIADIAVWPWYGQLVRNNVYSAAEFLSAHEYTHVQ
RWAEEIAKRPAVIRGQRVNRTWGDEASQVPERHDARDLG