Protein Info for PFR28_01943 in Pseudomonas sp. RS175

Annotation: Putative isomerase YbhH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04303: PrpF
  • amino acids 1 to 352 (352 residues), 405.6 bits, E=2e-125

Best Hits

Swiss-Prot: 63% identical to YBHH_ECOLI: Putative isomerase YbhH (ybhH) from Escherichia coli (strain K12)

KEGG orthology group: K09788, hypothetical protein (inferred from 91% identity to pba:PSEBR_a2303)

MetaCyc: 51% identical to 4-oxalomesaconate tautomerase (Pseudomonas putida KT2440)
RXN-9983 [EC: 5.3.2.8]

Predicted SEED Role

"FIG00958979: hypothetical protein"

MetaCyc Pathways

• gallate degradation I (1/4 steps found)
• methylgallate degradation (2/6 steps found)
• gallate degradation II (1/5 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• superpathway of vanillin and vanillate degradation (4/10 steps found)
• syringate degradation (3/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.8

Protein Sequence (360 amino acids)

>PFR28_01943 Putative isomerase YbhH (Pseudomonas sp. RS175)
MQRIPCVLMRGGTSKGPVFLAWDLPASVTERDELLLDLMGSGHELEIDGIGGGSPQTSKV
AIVSPSLHPEADVDYLFVQVMVSQRRVDTAPNCGNMLCAVGPFAIEQGLVKAGGDLTRVR
IRNLNTGTFVVSEVQTPGGKVSYEGDTAIDGVPGTAAPVQLTFLDAAGSKTGKLFPTGQV
LDLIDGILVTCIDMAMPMVIVEASQLGKRGDESPAELDADHDFLQRLESLRLKAGLAMGL
GDVSDKVIPKPVLVSPASSGGTLQVRYFMPHNCHRALAITGSIGLATACVTEGSVAARLT
GGPGEPRLQRVRIEHPSGAIDVVLSYVGEHGETIRASVVRTARRLFSGFVYAKASHRLAG