Protein Info for PFR28_01937 in Pseudomonas sp. RS175

Annotation: Sulfate/thiosulfate import ATP-binding protein CysA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR03265: putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein" amino acids 5 to 346 (342 residues), 492.7 bits, see alignment E=3.3e-152 PF00005: ABC_tran" amino acids 21 to 161 (141 residues), 116.4 bits, see alignment E=2.4e-37 PF08402: TOBE_2" amino acids 272 to 345 (74 residues), 27.4 bits, see alignment E=4.5e-10

Best Hits

Swiss-Prot: 54% identical to CYSA2_CHRVO: Sulfate/thiosulfate import ATP-binding protein CysA 2 (cysA2) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: None (inferred from 78% identity to pba:PSEBR_a26)

Predicted SEED Role

"Ferric iron ABC transporter, ATP-binding protein" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>PFR28_01937 Sulfate/thiosulfate import ATP-binding protein CysA (Pseudomonas sp. RS175)
MATVDLQLRDIHKGFGTFKALDGVSLEVKAGELVCLLGPSGCGKTTLLRCIAGLERQGQG
SLHFAARDVSTLPPQARDYGILFQSYALFPNLTVIQNIAYGLSGRGRDEVRRRVDEMLEL
VSLGGSGHKYPAQLSGGQQQRVALARALAPGPSLLLLDEPMSALDAQVREHLCGELRALQ
RRLGITTLMVTHNQEEAMLMADRIAVMNQGRIEQYATPQAVYNTPATPFVAEFVGQGNWL
PFQRDGQHARVGGLSMRLPDTGPGGDGRLFCRPEAIRVNPRFEQDNLFPARMRELTFLGN
RCRLSFELEDLPGHALLAEMSPEALPHLHGQQIRVALPPSSLQVFA