Protein Info for PFR28_01871 in Pseudomonas sp. RS175

Annotation: putative RNA polymerase sigma factor FecI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02937: RNA polymerase sigma factor, sigma-70 family
  • amino acids 12 to 164 (153 residues), 62.6 bits, E=1.7e-21
• PF04542: Sigma70_r2
  • amino acids 15 to 81 (67 residues), 43.7 bits, E=3.9e-15
• PF07638: Sigma70_ECF
  • amino acids 105 to 160 (56 residues), 25.9 bits, E=1.7e-09
• PF08281: Sigma70_r4_2
  • amino acids 112 to 164 (53 residues), 61.3 bits, E=1.1e-20
• PF04545: Sigma70_r4
  • amino acids 117 to 162 (46 residues), 26.4 bits, E=8.1e-10

Best Hits

Swiss-Prot: 48% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 92% identity to pba:PSEBR_a2951)

MetaCyc: 48% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Protein Sequence (169 amino acids)

>PFR28_01871 putative RNA polymerase sigma factor FecI (Pseudomonas sp. RS175)
MFDAATPAEQSLHTLYRDHGSWLEGWLRRRMGNAWDAADLRQDTFLRVLSSAQPLADLHE
PRAYLLTIGKRLLSNFYTRRNLEQAYLDALASLPEACVPSPEQRWLLLETLHALDELLDG
LPPLVRRAFLWSQLEGLGYREIAERMQVSERTIKRYMAQAYEHCLLVDF