Protein Info for PFR28_01802 in Pseudomonas sp. RS175

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 867 PF13188: PAS_8" amino acids 98 to 141 (44 residues), 16.4 bits, see alignment 3.1e-06 amino acids 215 to 258 (44 residues), 20.8 bits, see alignment 1.3e-07 PF12860: PAS_7" amino acids 100 to 200 (101 residues), 45.6 bits, see alignment E=3.2e-15 amino acids 220 to 321 (102 residues), 58.8 bits, see alignment E=2.6e-19 TIGR00229: PAS domain S-box protein" amino acids 326 to 449 (124 residues), 40.5 bits, see alignment E=1.4e-14 PF08448: PAS_4" amino acids 336 to 444 (109 residues), 92.6 bits, see alignment E=8.2e-30 PF13426: PAS_9" amino acids 360 to 441 (82 residues), 20.9 bits, see alignment E=1.6e-07 PF00512: HisKA" amino acids 502 to 566 (65 residues), 41.3 bits, see alignment 5.9e-14 PF02518: HATPase_c" amino acids 613 to 720 (108 residues), 78.4 bits, see alignment E=2.6e-25 PF00072: Response_reg" amino acids 745 to 856 (112 residues), 38.6 bits, see alignment E=5e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2650)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (867 amino acids)

>PFR28_01802 Sensor histidine kinase RcsC (Pseudomonas sp. RS175)
MPDIASPAIAELQAQLAKLQHENRKLRRINDALIERVESGVTRGSDPYAAFQHSVVLAEQ
VRERTDALNQAMAELKAGNHLLGEARLRAEMAHRHLIDAIESISDAFVLFDEQQRIVLFN
SRFKAFWAHSRVRIIAGMRLGEVKRLMTANGLFSEETRGQDDEHVLYRLQNGRWLQVSER
PTQEGGRVILFTDITDVKLSETVRREQAVAQKSHLLQRAVDNLSQGVAMVNAQGVLELWN
RRFLELSGLAPVAAHRPFNEVIADSELQLLTPASRDGNGRLIHECEQRLSDGRVLEIRTH
PLPTGGYVNTFTDITERYQHAEALSESERWIRLITDHVPALIAYLNADLVYEFTNKVYEQ
WYCWPRGVMLGQSLREAHSEQHYQRLEAYVARALAGESVTFEFAETNINNQERYMLRSYV
PNRLANGEVVGIFVLIRDITERRRTAEALHQAYQNLEQRVQERTAELTTLNDQLLREIDE
RSRVEVRLREAKREAEQANLSKTKFLAAVSHDLLQPLNAARLFTSALLERREPVANAQLV
RNVSNSLQDVENLLGTLVDISKLDAGVIKADVAPFALSELLDNLAAEYAQVARSEGLGLR
FVPCSVLVRSDMQLLARILRNLLSNAIRYTPSGRVVLGCRRHRRQVSIQVWDSGIGIAEE
RLEEIFQEFKRGDVQRPDQDRGLGLGLAIVEKIAGILGHRIQVRSWPGKGSMFSIDVPLS
ATAPTPQPCLDMSEPMLERLRGARIWVLDNDAAICAGMRTLLQGWGCQVVTALSEQDLAG
QVDCAHAEVDLLIADYHLDNDQNGVDAVARINAQRASAIPAMLITANYSNELKQQIRERG
HTLMHKPVRPMKLKTAMSHLLGQPRNH