Protein Info for PFR28_01794 in Pseudomonas sp. RS175
Annotation: putative tautomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 57% identical to Y2002_DICD3: Probable tautomerase K2 (Dda3937_02002) from Dickeya dadantii (strain 3937)
KEGG orthology group: K01821, 4-oxalocrotonate tautomerase [EC: 5.3.2.-] (inferred from 96% identity to pba:PSEBR_a3190)Predicted SEED Role
"4-oxalocrotonate tautomerase (EC 5.3.2.-)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 5.3.2.-)
MetaCyc Pathways
- 3-chlorocatechol degradation III (meta pathway) (2/4 steps found)
- orthanilate degradation (2/5 steps found)
- protocatechuate degradation III (para-cleavage pathway) (2/5 steps found)
- catechol degradation to 2-hydroxypentadienoate II (1/4 steps found)
- catechol degradation II (meta-cleavage pathway) (3/7 steps found)
- 4-amino-3-hydroxybenzoate degradation (2/6 steps found)
- 2,3-dihydroxybenzoate degradation (1/5 steps found)
- meta cleavage pathway of aromatic compounds (3/10 steps found)
- toluene degradation IV (aerobic) (via catechol) (4/13 steps found)
- 2,2'-dihydroxybiphenyl degradation (1/10 steps found)
- superpathway of aerobic toluene degradation (11/30 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (10/42 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.3.2.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (68 amino acids)
>PFR28_01794 putative tautomerase (Pseudomonas sp. RS175) MPFVNVRITRDGVTREQKAQVIAEITDTLQRVLGKDPHLTHIVIEEVDTDNWGYAGMTTT HYRSLPKE