Protein Info for PFR28_01786 in Pseudomonas sp. RS175

Annotation: Hydrogen cyanide synthase subunit HcnC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01266: DAO
  • amino acids 8 to 345 (338 residues), 195.8 bits, E=1.6e-61
• PF13450: NAD_binding_8
  • amino acids 11 to 40 (30 residues), 27.4 bits, see alignment (E = 3.3e-10)

Best Hits

KEGG orthology group: None (inferred from 90% identity to pba:PSEBR_a3197)

MetaCyc: 66% identical to D-hydroxyproline dehydrogenase beta subunit (Pseudomonas aeruginosa PAO1)
1.14.19.-

Predicted SEED Role

"D-amino-acid oxidase (EC 1.4.3.3)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 1.4.3.3)

MetaCyc Pathways

• trans-4-hydroxy-L-proline degradation II (4/4 steps found)
• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• L-lysine degradation V (6/9 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (4/7 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• superpathway of L-lysine degradation (18/43 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• D-Arginine and D-ornithine metabolism
• Glycine, serine and threonine metabolism
• Penicillin and cephalosporin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.3

Protein Sequence (371 amino acids)

>PFR28_01786 Hydrogen cyanide synthase subunit HcnC (Pseudomonas sp. RS175)
MSEGAVADVIVIGAGIIGAACARALAQRGVRALVLDAGWHGATAAGMGHLLVLDDNPAEL
ALSQYSLGRWRELADALPPGCAWRNNGTLWLAANPEEMAVAHSKYLNLLAHGEACELIGQ
ASLQQREPGLRKGLEGGLLINGDAILYAPAAARWMLDNPLIDQQRAQVVEVDGQRVRLDD
GRWLRADAVILANGIQATDLCPELPIEPKKGHLLITDRYPATVTHTLVELGYVTSAHNAS
GPSVACNIQPRPTGQLFIGASRQFGTVDPQVEGWMLARMLKRAVDYLPGLAQLNGIRAWT
GFRAASPDGLPLVGQHPRRKGLWLAVGHEGLGVTTAPATADLLVAQLFNETSPLAARPYL
PQRFLGEPAHA