Protein Info for PFR28_01782 in Pseudomonas sp. RS175

Annotation: Membrane-bound lytic murein transglycosylase F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00497: SBP_bac_3
  • amino acids 36 to 257 (222 residues), 173.5 bits, E=7.3e-55
• PF12974: Phosphonate-bd
  • amino acids 67 to 216 (150 residues), 27.3 bits, E=3.8e-10
• PF09084: NMT1
  • amino acids 72 to 200 (129 residues), 24.8 bits, E=2.9e-09

Best Hits

KEGG orthology group: K10039, putative glutamine transport system substrate-binding protein (inferred from 93% identity to pba:PSEBR_a3201)

Predicted SEED Role

"ABC transporter, substrate binding protein"

Protein Sequence (272 amino acids)

>PFR28_01782 Membrane-bound lytic murein transglycosylase F (Pseudomonas sp. RS175)
MKNPALAVALSVVLTPLLVSPAQADKLDDIIGSGKLRCAVTLDFPPMGSRDESNKPVGFD
VDYCHDLAKVLGVEAEVVETPFPDRIPALISGRADVIVASTSDTLERAKTVGLTVPYFAF
QMVVLTRDNTGINSYADLKGKALGNTSGTYEAIALEKDQKSWGSGSFRAYQSQNDTLLAV
AQGHIDATVVTNTVAAATIKSGKYKNLKIAGDAPYVIDYVSLGAKRNEYGLINYLNLFIN
QQVRTGRYKELFTKWVGTDIPPTDLTVPQVYY