Protein Info for PFR28_01780 in Pseudomonas sp. RS175

Annotation: Octopine transport system permease protein OccM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 75 to 100 (26 residues), see Phobius details amino acids 134 to 172 (39 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 112 (98 residues), 86.5 bits, see alignment E=7e-29 PF00528: BPD_transp_1" amino acids 36 to 217 (182 residues), 61.5 bits, see alignment E=4.5e-21

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 96% identity to pba:PSEBR_a3203)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>PFR28_01780 Octopine transport system permease protein OccM (Pseudomonas sp. RS175)
MFDYSFQWRPALRALPDMLAGAWVTFETAALSMIFGVLIALLLTVMRQARNPLLRGVGNG
WVSIARNTPSLFQIYILYFGLGSLGLHVSSWLALLAGITFNNAGYLAENLRGGLRAVPDT
QMRAARSLGMSASQAYRMIIVPQLLRIVFYPLTNQMVWAVLMTSLGVVVGLNNDLTGVTQ
EYNVKTFRTFEYFALAALLYYLIAKAIVGLARLLSWRLFRY