Protein Info for PFR28_01779 in Pseudomonas sp. RS175

Annotation: Arginine transport system permease protein ArtQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 146 to 148 (3 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 107 (96 residues), 60.4 bits, see alignment E=1e-20 PF00528: BPD_transp_1" amino acids 32 to 212 (181 residues), 52.6 bits, see alignment E=2.5e-18

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 94% identity to pba:PSEBR_a3204)

Predicted SEED Role

"Probable permease of ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>PFR28_01779 Arginine transport system permease protein ArtQ (Pseudomonas sp. RS175)
MFATSLTLNDLLFLLDGAWVTVQLTAWSILLGTLAGLLFGLLRALMPRASLPLAWVLDVF
RSVPLLIQFVLFNSLKSIAGLDLSAFAVGCIVLGIYAAAYFTEIVRGGVLAVPLSTRRAS
RSLGLSYLQDLRFIVLPIATRVAFPGWLNLVLGVMKDTALVMWIGIVELLRASQTIVTRI
QEPLLVLCIAGLIYYVMSLVVARLGARLERRWQEND