Protein Info for PFR28_01712 in Pseudomonas sp. RS175

Annotation: sn-glycerol-3-phosphate transport system permease protein UgpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 28 to 53 (26 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 116 to 305 (190 residues), 59 bits, see alignment E=2.7e-20

Best Hits

Swiss-Prot: 35% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K10228, sorbitol/mannitol transport system permease protein (inferred from 97% identity to pba:PSEBR_a3087)

MetaCyc: 91% identical to polyol ABC-type transporter permease component MtlF (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 1" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>PFR28_01712 sn-glycerol-3-phosphate transport system permease protein UgpA (Pseudomonas sp. RS175)
MNSSTTTVKAPLEIAPPVRKVRVANPGWFLVSPSVALLLLWMIVPLGMTVYFSMIRYNLL
YPGENEFVGLENFTYFLTDSGFMPGATNTLLLVGSVLLISVVFGVLISALLEASEFFGRG
IVRVLLISPFFIMPTVGSLIWKNLIFHPVSGILASVWKLFGAQPVDWLAHYPLLSIIIIV
SWQWLPFAILILMTAMQSLDQEQKEAARLDGAGPIAIFWHLTLPHLARPIAVVLMIETIF
LLSVFAEIFTTTNGGPGYASTNLAYLIYNQALVQFDVGMASAGGLIAVVIANIAAIILVR
MIGKNLTDKH