Protein Info for PFR28_01702 in Pseudomonas sp. RS175

Annotation: Non-homologous end joining protein Ku

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR02772: Ku protein" amino acids 2 to 262 (261 residues), 318.9 bits, see alignment E=1.3e-99 PF02735: Ku" amino acids 11 to 175 (165 residues), 161.1 bits, see alignment E=1.5e-51

Best Hits

Swiss-Prot: 72% identical to KU_PSESM: Non-homologous end joining protein Ku (ku) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K10979, DNA end-binding protein Ku (inferred from 93% identity to pba:PSEBR_a3097)

Predicted SEED Role

"Ku domain protein" in subsystem DNA Repair Base Excision

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>PFR28_01702 Non-homologous end joining protein Ku (Pseudomonas sp. RS175)
MARAIWKGAISFGLVHIPVALVSATSSQGVDFDWLDKRSMDPVGYKRVNKVTGKEVTKED
IVKGVEYQKGQYVLLSEEEIRSAHPKSTQTIDIFSFVDSEKIPLQNIDTPYFLAPDKRGG
KVYALLRETLVKTNKVALAHVVLHTRQHLAALMPLESALVLVMLRWPAEVRDLDILELGD
EVIHPTLAKGELEMAKRLVEDMSGDWEPQAYRDSFEDKIMELVEKKANEGRLEAVETDPG
EEQRKSADVIDLTELLKRSLGSKGKAADKPGGKTAEKAAKPRKSTPAKKATKASRG