Protein Info for PFR28_01635 in Pseudomonas sp. RS175

Annotation: Respiratory nitrate reductase 1 gamma chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00351: respiratory nitrate reductase, gamma subunit
  • amino acids 5 to 225 (221 residues), 270.6 bits, E=6.4e-85
• PF02665: Nitrate_red_gam
  • amino acids 6 to 225 (220 residues), 258.4 bits, E=2.6e-81

Best Hits

KEGG orthology group: K00374, nitrate reductase 1, gamma subunit [EC: 1.7.99.4] (inferred from 96% identity to pba:PSEBR_a3145)

MetaCyc: 75% identical to respiratory nitrate reductase gamma subunit (Stutzerimonas stutzeri)
RXN-11236 [EC: 1.7.5.1]

Predicted SEED Role

"Respiratory nitrate reductase gamma chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

MetaCyc Pathways

• nitrate reduction I (denitrification) (5/5 steps found)
• NADH to nitrate electron transfer (2/2 steps found)
• nitrate reduction IX (dissimilatory) (2/2 steps found)
• nitrate reduction VII (denitrification) (4/5 steps found)
• nitrate reduction III (dissimilatory) (1/2 steps found)
• nitrate reduction VIII (dissimilatory) (1/2 steps found)
• nitrate reduction VIIIb (dissimilatory) (1/2 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.5.1 or 1.7.99.4

Protein Sequence (226 amino acids)

>PFR28_01635 Respiratory nitrate reductase 1 gamma chain (Pseudomonas sp. RS175)
MSKWDLLLFGVYPYVALAVCLIGSWARFDLSQYTWKAGSSQMLSNRGMRVASNLFHIGVL
FVLAGHFVGLLTPSAIYHHVLSTENKQLLAMVSGGFFGVLGLIGLLMLLNRRLTDPRVRA
TSNTSDILVLVVLLVQLVLGLMTIVASTAHMDGSVMVMLADWAQNTVLLRPVEAATAMAP
VGLVYKLHVLLGLTLFVLFPFTRLVHIVSAPVWYLGRRYQIVRQKF