Protein Info for PFR28_01631 in Pseudomonas sp. RS175

Annotation: Nitrate/nitrite transporter NarK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 168 to 195 (28 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 436 to 456 (21 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 34 to 417 (384 residues), 375.8 bits, see alignment E=1.2e-116 PF07690: MFS_1" amino acids 43 to 371 (329 residues), 57.4 bits, see alignment E=6.1e-20

Best Hits

Swiss-Prot: 60% identical to NARK_ECOLI: Nitrate/nitrite transporter NarK (narK) from Escherichia coli (strain K12)

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 96% identity to pba:PSEBR_a3149)

MetaCyc: 60% identical to nitrate:nitrite antiporter NarK (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-239

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>PFR28_01631 Nitrate/nitrite transporter NarK (Pseudomonas sp. RS175)
MSVLQTPDKGPVIHDWRPEDPAFWGSSGKQTARRNLWISIPALLLAFAVWMVWSTVIVRL
NAIGFSFSTDQLFWLAALPGLSGATLRIFYSFMVPIFGGRRWTALSTASLLVPALWMGFA
VQDPGTPYSVFVLIALLCGFGGGNFASSMSNISFFYPKSQQGTALGLNAGLGNLGVSVMQ
FCVPLVISFGVFGFMGGEPQVLADGSSLWLQNAGFIWVPFILAVTLIAWFGMNDLSSARA
SFSEQAVIFKRKHNWLMCWLYLATFGSFIGFSAAFPLLIKTSFPEVIALKFAFLGPLVGA
LVRPLGGWLADKLGGAKVTLWNFVLMIAMVFGVMHFLPQGGQGGNFYGFLGLFMLLFITT
GVGNGSTFRMIPVIFRTLHEKAALGKKPEVREQALKNAGKESAAVLGFSSAMGAFGAFFI
PKSFGTSMALTGGPEMAFYMFVGFYLSCIVVTWWWYARKGAATPC