Protein Info for PFR28_01619 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details PF08269: dCache_2" amino acids 42 to 198 (157 residues), 116.6 bits, see alignment E=3.2e-37 PF17200: sCache_2" amino acids 48 to 190 (143 residues), 130 bits, see alignment E=1.8e-41 PF17201: Cache_3-Cache_2" amino acids 75 to 191 (117 residues), 53.4 bits, see alignment E=6.4e-18 PF07730: HisKA_3" amino acids 249 to 314 (66 residues), 52.7 bits, see alignment E=1.3e-17 PF02518: HATPase_c" amino acids 356 to 437 (82 residues), 40.1 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 40% identical to MCTS_RHIL3: Sensor histidine kinase MctS (mctS) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a2761)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>PFR28_01619 hypothetical protein (Pseudomonas sp. RS175)
MLLKHKIVALGILPLVLAIAVICVLVISLNRQLGDQQAQLIEDSILASKRAELKNYVEMA
QSLIAPLYNDGQGDEKAQQQVLEELRKLSFGINGYFFVYDRQGRSLMHARQSELVGQYLW
DMKDPHGLPVIQALIKSAESGEGFQRYAWNKPSSGQVTDKLAYVVMLDRWGWMLGTGIYL
EDVELATQKARDEVAQGIHTTMQAIAAVALVAVLLVFAGGMTLNVSEHRLADKKLQRLNQ
RIVSLQEEERSRVSRELHDGISQVLVSIKFQFELASHVLENGQENGLGILKNATDRLGQA
IGEIRSISHDLRSSLLDTLGLPAAIGQLAAEFEQRSGLEVSYRSNEFDCRLENGAPVSLF
RIAQEALTNIERHAGAKRVAITLFGSGQSLRLTVVDDGMGFNVPQVERGHAGIGLRNIRE
RVEHFGGRLELTSTPGRSELDVLLPMNMSVTQS