Protein Info for PFR28_01591 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 310 to 335 (26 residues), see Phobius details PF13519: VWA_2" amino acids 96 to 199 (104 residues), 39.3 bits, see alignment E=1.7e-13 PF07719: TPR_2" amino acids 403 to 435 (33 residues), 33.5 bits, see alignment (E = 5.2e-12) PF13181: TPR_8" amino acids 403 to 435 (33 residues), 25.6 bits, see alignment (E = 1.8e-09) PF00515: TPR_1" amino acids 403 to 435 (33 residues), 38.9 bits, see alignment (E = 1e-13)

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 89% identity to pba:PSEBR_a3256)

Predicted SEED Role

"TPR domain protein in aerotolerance operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (576 amino acids)

>PFR28_01591 hypothetical protein (Pseudomonas sp. RS175)
MISLWPHWLRPAFVLVLPLLGWLLWQLWHRQKRVGRWQMILPPAFHAVLLSGGSGRESRL
PWIALGLGWLLMVLALLGPSWARVEQTSQKPADPLVVVLELTPEMLATDVPPTRLEQARR
KLLDLLHNRSDAQTAIVVYAGSAHTLVPLSDDLATSANLLEALAPSIMPQGGHRADLAIN
KAMALLDQGGLGHGRILLIGSSLNEQERQGIRQVLDGSATRLLMLGIGTREGAPVAQGDG
SYLKDAQGAILVPRLDSPSLKAFINELDGRYRPARLDDSDLRGLGLLEGPRHLRQDGQTL
RLDTWADQGYWLLLPLLLLAACAGRRGWLFCLPLLFVLPQTGHAFEFEDLWLRPDQQGQH
LLKQKRPAEAAAHFEDSQWQGVALYEAGQYSEAARRFAEGSDARAHYNRGNALARSGELE
AALDAYEQALELQPDLRPAQTNKALVQSLLKEQTVPPDEPEPAESEASNPAEQSPGADTP
PQSSQAQSSSAEATTPPEEAQPSPTAPDGAQDVPGSELPDEQTTTPPLRPAAGRNEEEQR
QALEQWLRQIPDNPGELLRRKFWYEQQSHQAQGKTP