Protein Info for PFR28_01566 in Pseudomonas sp. RS175
Annotation: Arsenic resistance transcriptional regulator ArsR1
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 67% identical to ARSR1_PSEPK: Arsenic resistance transcriptional regulator ArsR1 (arsR1) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 71% identity to psa:PST_2096)MetaCyc: 54% identical to DNA-binding transcriptional repressor ArsR (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Arsenical resistance operon repressor" in subsystem Arsenic resistance
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (115 amino acids)
>PFR28_01566 Arsenic resistance transcriptional regulator ArsR1 (Pseudomonas sp. RS175) MPDSHNPVDVFKALADDTRTRIALLVAREGELCVCELTAALDQSQPKISRHLAQLRHAGL LSDRRQGQWVYYRLHPQLPSWVGTLLEQALAANAQWLAADVQRLTAMVDRPVRCC