Protein Info for PFR28_01501 in Pseudomonas sp. RS175

Annotation: Inner membrane protein YqjF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 32 to 56 (25 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details PF07291: MauE" amino acids 27 to 105 (79 residues), 28.9 bits, see alignment E=2e-10 PF07681: DoxX" amino acids 27 to 107 (81 residues), 68.5 bits, see alignment E=9.5e-23 PF02077: SURF4" amino acids 70 to 145 (76 residues), 33.6 bits, see alignment E=5e-12

Best Hits

KEGG orthology group: None (inferred from 69% identity to ppw:PputW619_3132)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>PFR28_01501 Inner membrane protein YqjF (Pseudomonas sp. RS175)
MTHPNVSSSTVTNTAFGPAASLSSSAAFAGRILLSAIFLLSGVSKIGASAGMVAYIESVG
LPFPSLALAIAILVEVVGGVALILGYRTRLVAAGLALFSVATALAFHNQLGDQNQFIHFF
KNIAMAGGLLQVVAFGAGRFSLDARRA