Protein Info for PFR28_01397 in Pseudomonas sp. RS175

Annotation: Anaerobic nitric oxide reductase transcription regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF00989: PAS" amino acids 31 to 83 (53 residues), 24.5 bits, see alignment 1e-08 PF08448: PAS_4" amino acids 34 to 125 (92 residues), 29.3 bits, see alignment E=4e-10 PF00158: Sigma54_activat" amino acids 167 to 334 (168 residues), 221.8 bits, see alignment E=2.1e-69 PF14532: Sigma54_activ_2" amino acids 167 to 338 (172 residues), 75.8 bits, see alignment E=1.8e-24 PF01078: Mg_chelatase" amino acids 179 to 277 (99 residues), 20.6 bits, see alignment E=1.2e-07 PF07728: AAA_5" amino acids 189 to 307 (119 residues), 29.2 bits, see alignment E=3.9e-10 PF02954: HTH_8" amino acids 434 to 470 (37 residues), 43.3 bits, see alignment 1.1e-14

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a1973)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>PFR28_01397 Anaerobic nitric oxide reductase transcription regulator NorR (Pseudomonas sp. RS175)
MPSLWKCPMNPTESLKDYKRVRTLAIRSLFEIIEQSSEGTVIVDRDANIVWMNERYARRF
GLNSAQEAIGRACESVIPGSLLREVVRTGRPILLDMQDTPKEPLVVMRLPIHDSAGAVIG
AIGFALFDELRSLSPMLKRYLSMQQELASTRSLLRARQTKYNFAHFIGTSSAGLEVKRRA
RRSASTESPVLLLGETGTGKELLAQAIHSASPRAHKAFVSINSAAIPEALLEAEFFGTAP
GAFTGADRKGRAGKLQIAQGGTLFLDEIGDMPLPLQSKLLRVLQEKEYEPVGSNEVLQSD
VRVIAATSMDLEAAIKRGEFRADLYYRLNVLPIQVPPLRERLDDLPALSEAILEELRSQH
ELAPAALDLLGQHAWPGNIRELRNVLERAALLSDNLLLSASDIRAAIGTFIPVTRPADMG
FEPQPQETFSQARARFDRHLIETTLAQCGGKVVEAAERLGLGRSTLYKKMVALGIAESQ