Protein Info for PFR28_01313 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 38 to 467 (430 residues), 560.9 bits, see alignment E=1e-172 PF12801: Fer4_5" amino acids 94 to 120 (27 residues), 23.4 bits, see alignment (E = 1.9e-08) amino acids 196 to 235 (40 residues), 8.4 bits, see alignment 0.00094 PF13746: Fer4_18" amino acids 216 to 322 (107 residues), 144.1 bits, see alignment E=8.3e-46 PF13183: Fer4_8" amino acids 220 to 283 (64 residues), 27.2 bits, see alignment E=1.9e-09 PF11614: FixG_C" amino acids 352 to 467 (116 residues), 101.2 bits, see alignment E=1.7e-32

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a1895)

Predicted SEED Role

"4Fe-4S ferredoxin, iron-sulfur binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>PFR28_01313 hypothetical protein (Pseudomonas sp. RS175)
MSDRIPVQLIQTFDPTPGKIKARSTDNLIHTRSFTGLFRTLRMSGAGFLFLLFFGTVWLN
WGGRQAVLWDLSESKFHIFGATFWPQDFILLSALLIIAAFGLFAITVFAGRVWCGYTCPQ
SSWTWIFMWCEKITEGDRNQRIKLQAAPWSLNKLLRRSAKHTLWLGISLLTGLTFVGYFT
PIRPLAEELLTLQIAGVSLFWVLFFTGATYLNAGWLREAVCMHMCPYARFQSVMFDKDTL
TISYDSARGEIRGPRKRDVKPANIGLGDCIDCQMCVQVCPTGIDIRDGLQMECIGCAACI
DACDSIMDRMGYARGLIKYTSEHQLQGGKTHLLRPRLVGYTAVLLVMIAALTIALVQRPM
VSLDVSKDRGLFRENSQGLIENIYSLKIINKTQQRQDYHLSLVDGDGFVLQGKTQLSLAP
GEIVDVPVSVAMLSERPRSGSQDMTFKVTDSDDPGIHSVAKSRFVAPMNR