Protein Info for PFR28_01268 in Pseudomonas sp. RS175

Annotation: Arginine N-succinyltransferase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF04958: AstA" amino acids 1 to 336 (336 residues), 384.3 bits, see alignment E=1.8e-119 TIGR03243: arginine and ornithine succinyltransferase subunits" amino acids 4 to 338 (335 residues), 381.1 bits, see alignment E=2e-118

Best Hits

Swiss-Prot: 62% identical to ASTA_PSEAE: Arginine N-succinyltransferase subunit alpha (astA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00673, arginine N-succinyltransferase [EC: 2.3.1.109] (inferred from 87% identity to pba:PSEBR_a1856)

MetaCyc: 62% identical to arginine succinyltransferase alpha subunit (Pseudomonas aeruginosa)
Arginine N-succinyltransferase. [EC: 2.3.1.109]; 2.3.1.109 [EC: 2.3.1.109]

Predicted SEED Role

"Arginine N-succinyltransferase, alpha subunit (EC 2.3.1.109)" in subsystem Arginine and Ornithine Degradation (EC 2.3.1.109)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.109

Use Curated BLAST to search for 2.3.1.109

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>PFR28_01268 Arginine N-succinyltransferase subunit alpha (Pseudomonas sp. RS175)
MLALRPVQPSDLPQLQQLARDSLVGVTSLPDDIERLREKILDSCASFEADVRAPGGENYF
FVLQDLVSGRLVGCSEILASTGCNEPFYSLRNRPFSSESRELNIQHGVPALSLCQDLQGQ
TLLRGFHIDADRVRTAESELLSRARLMFIAAHPQRFAESVITEIVGYSDDDGQSPFWDAI
GQHFFDLPYVEAERLCGLQSRSFLAELMPQYPLYVPMLPPEAQACIGRVHPDGQEAFDIL
AREGFETNSYVDLFDGGPTLHARIANIRSIARSRMVQTWKSSQIDARGRYLVSNDRLADY
RAIVAELDVAAEGPVALTPDMLAALDIDEGERIRVITL