Protein Info for PFR28_01227 in Pseudomonas sp. RS175

Annotation: Trigger factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR00115: trigger factor" amino acids 2 to 396 (395 residues), 459.6 bits, see alignment E=4.5e-142 PF05697: Trigger_N" amino acids 2 to 128 (127 residues), 136.9 bits, see alignment E=9.4e-44 PF00254: FKBP_C" amino acids 142 to 223 (82 residues), 63.1 bits, see alignment E=3.8e-21 PF05698: Trigger_C" amino acids 249 to 397 (149 residues), 131.3 bits, see alignment E=5.4e-42

Best Hits

Swiss-Prot: 93% identical to TIG_PSEF5: Trigger factor (tig) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03545, trigger factor (inferred from 97% identity to pba:PSEBR_a1813)

MetaCyc: 50% identical to trigger factor (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>PFR28_01227 Trigger factor (Pseudomonas sp. RS175)
MSIIVPADRIETQVNKRLQQTAQKAKIPGFRPGKVPMSVIRQRYEADARQEAVGDVIQSS
FYEAVVEQKLNPAGAPSVEPKVLEKGKDLEFVATFEVFPEFTVAGFESIAVERLSAEVSD
ADLDKMLDILRKQNTRFEVTDRAAQNEDQLNIDFVGKVDGEVFAGGSAKATQLVLGSGRM
IPGFEDGLVGAKAGEERVLNVTFPEDYQNLDLAGKAAEFTVTVNSVSEPKLPELNEEFFA
QFGIKETGLDGFRAEVRKNMERELRQAIKSKIKNQVMDGLLASNPIEVPKALLDNEVNRL
RVQAVQQFGGNIKPDQLPAELFEEQAKRRVVLGLIVAEVVKQYELKPDDARVRELIQEMA
SAYQEPEQVVSWYYKNEQQLNEVRSVVLEEQVVDTVLQKASVTDKAVSYEEAVKPVEAAQ
AD