Protein Info for PFR28_01185 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR01551: phage major capsid protein, P2 family" amino acids 8 to 331 (324 residues), 307.7 bits, see alignment E=4.5e-96 PF05125: Phage_cap_P2" amino acids 9 to 332 (324 residues), 480.4 bits, see alignment E=1.4e-148

Best Hits

Swiss-Prot: 55% identical to CAPSD_BPP2: Capsid proteins (N) from Escherichia phage P2

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU1588)

Predicted SEED Role

"Phage capsid protein" in subsystem Phage capsid proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>PFR28_01185 hypothetical protein (Pseudomonas sp. RS175)
MRNDTRVLFNAYLQQLAQLHGVTDVTTKFTADPSVAQTLETRIQESSAFLSAINVYGVSE
QSGEKVGIGIDGTIASTTDTTTKDREPRDPSGLDDRGYTCTQTNFDTSLRYQKLDQWAKF
KDFQARIRDAIIKAQALNRIMIGWNGISRAATSNPAINQLLQDVNIGWLQKMRLENPARV
LDEVVAGSGKIEIGAGKDFENIDALVVSMVNEFIEPWYQEDTELVVICGRQLLADKYFPI
INKTQAPTEMLAADIVTSQKRLGNLPAVRVPHFPANGLLVTRLDNLSLYWQEGTRRRTVV
DNAKRDRIENYESVNESYVIEDLGCAAMAENITLN