Protein Info for PFR28_01132 in Pseudomonas sp. RS175

Annotation: Lipoprotein-releasing system transmembrane protein LolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 34 to 60 (27 residues), see Phobius details amino acids 283 to 307 (25 residues), see Phobius details amino acids 327 to 355 (29 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 16 to 425 (410 residues), 504.9 bits, see alignment E=8.5e-156 PF12704: MacB_PCD" amino acids 39 to 252 (214 residues), 69.3 bits, see alignment E=5.8e-23 PF02687: FtsX" amino acids 286 to 419 (134 residues), 67.5 bits, see alignment E=1.1e-22

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 96% identity to pba:PSEBR_a1768)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>PFR28_01132 Lipoprotein-releasing system transmembrane protein LolE (Pseudomonas sp. RS175)
MRRVIYLFTVPRMFRPLSIFIGTRYTRAKRRNRFVSFISMTSMIGLALGVLAMIVVLSVM
NGFQREMSSRILGMVPHATIVGVNPIDDWQPVAAAALNNPQVTAAVPFTEMEGMLSHKGS
MQPIQISGIDPAQEGKVSIVAQHIVQGRLDALKPGEYGVVIGEITARRFRLNVGDKLTLI
VPEVSTAPGGITPRMQRLNVVGVFKVGAELDGSMALIHLADAAQMQHWQPNQVQSVRLAV
KDLYAAPKVSGDIASSLGAGYKADDWTHTQGSLFSAMKMEKTMIGLLLLMIVAVAAFNII
ATLIMVVNEKGADIAILRTIGATPRQIMAIFMVQGTVIGVVGTVIGGVLGVIAALNVSEL
VGWLERVSGQHIFSSDVYFISNLPSELQRGDVILICAAGFILSFLATIYPAWRAAKTEPA
QALRYS