Protein Info for PFR28_01130 in Pseudomonas sp. RS175

Annotation: Lipoprotein-releasing system transmembrane protein LolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 22 to 48 (27 residues), see Phobius details amino acids 273 to 297 (25 residues), see Phobius details amino acids 317 to 354 (38 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 5 to 416 (412 residues), 557.5 bits, see alignment E=8.9e-172 PF12704: MacB_PCD" amino acids 27 to 197 (171 residues), 62.1 bits, see alignment E=9.2e-21 PF02687: FtsX" amino acids 276 to 409 (134 residues), 68.7 bits, see alignment E=4.5e-23

Best Hits

Swiss-Prot: 46% identical to LOLC_XYLFA: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 92% identity to pfo:Pfl01_3859)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>PFR28_01130 Lipoprotein-releasing system transmembrane protein LolE (Pseudomonas sp. RS175)
MFRPLFVFIGTRYTRAKRRNHFVSFISLTSIIGLALGVVVMIVVLSVMNGFDHEMRTRVL
GMVPHATVESGEAISDWPSLAAQVKHNPQVLAVAPFTQMQGLLTNDGKVSKVLLNGIDPG
LERQVSIIDNFMRQGRLDDLAPGSFGIVIGDKAATKLGVAIGDKLTFVAPEVTVTPGGMF
PRMKRFTVVGIFHVGAGELDGYLGVTNLQDLARLHRWKPDQVQGLRLKFDDLFQAPRVAW
NIAQQLGEDRYYARDWTRTHGNLYQAIRMEKAMIGLLLLLIVAVAAFNIISTLVMVVNDK
KGDIAILRTLGATPGQIMRIFMVQGTVIGVIGTIVGALVGMFAALNVSAAIAALEGLIGH
KFLNADVYFIDYLPSQLQSDDVVMVCGAALILSFLATLYPAWRAARTQPAEALRYE