Protein Info for PFR28_01124 in Pseudomonas sp. RS175

Annotation: Glyceraldehyde-3-phosphate dehydrogenase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00044: Gp_dh_N
  • amino acids 138 to 248 (111 residues), 65.9 bits, E=3.6e-22
• TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I
  • amino acids 139 to 472 (334 residues), 368.7 bits, E=1.4e-114
• PF02800: Gp_dh_C
  • amino acids 303 to 460 (158 residues), 149.5 bits, E=6.2e-48

Best Hits

Swiss-Prot: 87% identical to GAP2_PSEAB: Glyceraldehyde-3-phosphate dehydrogenase-like protein (gap2) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 96% identity to pfl:PFL_1955)

Predicted SEED Role

"NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.13)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (17/17 steps found)
• Bifidobacterium shunt (15/15 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• gluconeogenesis I (11/13 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• glycolysis IV (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• oxygenic photosynthesis (12/17 steps found)
• gluconeogenesis III (8/12 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• glycerol degradation to butanol (9/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.12 or 1.2.1.13

Protein Sequence (487 amino acids)

>PFR28_01124 Glyceraldehyde-3-phosphate dehydrogenase-like protein (Pseudomonas sp. RS175)
MWKVPVTQKPDQCLGEWIDREALAEAMIPLIGQLYRNNNVVSSIYGRSLINQSVIAILKA
HRFARHRQSDDSELSVHETFPLLKAMSELKLGAASVDLGKLAVKFKAQGNGRSAEQFVRE
ELADVVGQQNASARKGTDVVLYGFGRIGRLLARILIEKTGGGDGLRLRAIVVRKGAENDL
TKRASLLRRDSVHGSFNGTIIIDEENNTICANGNLIQVIYAKNPTEVDYTQYGIKDALLV
DNTGVWRDADGLGQHLACPGIDRVVLTAPGKGKLKNIVHGINHGDITAEDKIVSAASCTT
NAIVPVLKAVNDKFGIVNGHVETVHSYTNDQNLIDNFHKGDRRGRSAALNMVITETGAAT
AAAKALPELAGKLTGNAIRVPTPNVSMAILNLNLEKATSREEMNEYLRYVALHSELHKQI
DFVNSQEVVSTDFVGSRHAGVVDAEATICNDNRVVLYVWYDNEFGYSCQVVRVMEDMAGV
NPPAFPR