Protein Info for PFR28_01102 in Pseudomonas sp. RS175

Annotation: Multidrug resistance protein NorM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 250 to 276 (27 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 360 to 378 (19 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details amino acids 432 to 453 (22 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 30 to 426 (397 residues), 351 bits, see alignment E=4.2e-109 PF01554: MatE" amino acids 30 to 189 (160 residues), 131.2 bits, see alignment E=1.5e-42 amino acids 256 to 416 (161 residues), 124.9 bits, see alignment E=1.3e-40

Best Hits

Swiss-Prot: 72% identical to PMPM_PSEAE: Multidrug resistance protein PmpM (pmpM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 96% identity to pba:PSEBR_a1738)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>PFR28_01102 Multidrug resistance protein NorM (Pseudomonas sp. RS175)
MNPVIDTAVTLSRPARVRLELKTLLALALPIMVAQLATTAMGFVDAVMAGRVGPRDLAAV
ALGNSIWVPVFLLMTGTLLATTPKVAQRFGAGTFDEIGPLVRQALWLALAVGLLATLALY
SAEPILHLMKVDPELVGPCMEYLRGIGSGLPAVALYHVLRCFSDGLGRTRPAMVLGLCGL
ALNIPLNYIFIYGHLGVPAMGGVGCGWATAIVMWVMALGMAGWARWAPAYRSSRLFSRFD
WPQWTVIKRLLGIGLPIGIAVFAESSIFAVIALLIGSLGATVVAGHQIALNFSSLVFMIP
YSLGMAVTVRVGQALGRRQPREARFAAGVGMGAALAYACLSASLMFGLRGPIASIYTADP
VVIEVASMLIVYAALFQFSDGIQVTAAGALRGYQDTRVTMILTLFAYWGIGLPVGYALGL
TDWLGAASGPSGLWQGLIVGLSCAALMLSIRLARSARKQIRISRSAG