Protein Info for PFR28_01061 in Pseudomonas sp. RS175

Annotation: Guanine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02967: guanine deaminase
  • amino acids 28 to 428 (401 residues), 636.7 bits, E=8e-196
• PF01979: Amidohydro_1
  • amino acids 70 to 431 (362 residues), 222.8 bits, E=7.8e-70
• PF07969: Amidohydro_3
  • amino acids 269 to 432 (164 residues), 51.6 bits, E=1.2e-17

Best Hits

Swiss-Prot: 61% identical to GUAD_ECOLI: Guanine deaminase (guaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a1700)

MetaCyc: 61% identical to guanine deaminase (Escherichia coli K-12 substr. MG1655)
Guanine deaminase. [EC: 3.5.4.3]

Predicted SEED Role

"Guanine deaminase (EC 3.5.4.3)" in subsystem Purine Utilization or Purine conversions (EC 3.5.4.3)

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.3

Use Curated BLAST to search for 3.5.4.3

Protein Sequence (434 amino acids)

>PFR28_01061 Guanine deaminase (Pseudomonas sp. RS175)
MPLTRKAYRAALLHSLADPAEAGIEASYEYFEDGLLVVENGQISAIGPACDLLPTLAADI
EIVHHQDALITPGFIDTHIHLPQTGMVGAYGEQLLDWLDTYTFPCESQFADKAHADAVAD
IFVKELLRNGTTTALVFGSVHPQSVNAFFEVAQKLDLRMIAGKVMMDRNAPDYLVDTAES
SYTQSKALIERWHGKGRLHYAVTPRFAPTSTPEQLALAGQLLREYPDLYMQTHISENLQE
VQWVKSLFPERKGYLDVYDHYQLLGQRSVLAHGVHLCDDECARLAETGSAIAFCPTSNLF
LGSGLFNLPMAEKHKVNVGLGTDVGGGTSFSLLQTLNEAYKVMQLQGARLSPFKSLYLAT
LGGARALRLEDRIGTLQPGTDADFLVLDYNATPLLSYRLKQAKDIAERLFVLMTLGDDRT
VAQTYAAGKLVHQR