Protein Info for PFR28_01004 in Pseudomonas sp. RS175

Annotation: Molybdenum cofactor guanylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR02665: molybdenum cofactor guanylyltransferase" amino acids 10 to 192 (183 residues), 194.8 bits, see alignment E=7.3e-62 PF12804: NTP_transf_3" amino acids 13 to 169 (157 residues), 118 bits, see alignment E=2.4e-38

Best Hits

Swiss-Prot: 75% identical to MOBA_PSEPF: Molybdenum cofactor guanylyltransferase (mobA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03752, molybdopterin-guanine dinucleotide biosynthesis protein A (inferred from 85% identity to pba:PSEBR_a1647)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>PFR28_01004 Molybdenum cofactor guanylyltransferase (Pseudomonas sp. RS175)
MTSNISRPPCSILLLAGGRGQRMGGQDKGLVEWRGEPLIAHLHRQTRALSDDLIISCNRN
LERYALYADQLVHDDEGDFPGPLAGIRAGLRAARHRFLLVLPCDVPNIDSNLLESMLETA
SQHPDRPLMVRHGEHWEPLLCVIPLALAAAFEQAWGEGERSPGRIMRTLHAVALQCPADD
PRLANLNTPELLNRHTGH