Protein Info for PFR28_00941 in Pseudomonas sp. RS175

Annotation: Potassium-transporting ATPase KdpC subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00681: K+-transporting ATPase, C subunit" amino acids 5 to 181 (177 residues), 188.2 bits, see alignment E=7.6e-60 PF02669: KdpC" amino acids 5 to 179 (175 residues), 211.2 bits, see alignment E=5.5e-67

Best Hits

Swiss-Prot: 76% identical to KDPC_PSEPK: Potassium-transporting ATPase KdpC subunit (kdpC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01548, K+-transporting ATPase ATPase C chain [EC: 3.6.3.12] (inferred from 88% identity to pfo:Pfl01_4031)

Predicted SEED Role

"Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>PFR28_00941 Potassium-transporting ATPase KdpC subunit (Pseudomonas sp. RS175)
MSTLIRPALSLLLLMTLITGVAYPLVVTGVAQVAFPAQANGSLVRDADGKVRGSMLIAQD
FQGDAWFHPRPSAGAFATVASGASNLSPSNPALAARVTDEARKLQVTGQGPVPLALLTTS
GSGLDPHLPPAAIAYQLARVAAARSLPVSAVQQLLEAHIEQPLVGPPVVNVLALNLALEK
L