Protein Info for PFR28_00932 in Pseudomonas sp. RS175

Annotation: UDP-N-acetyl-alpha-D-glucosamine C6 dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details PF13727: CoA_binding_3" amino acids 70 to 255 (186 residues), 28.6 bits, see alignment E=4.3e-10 PF04321: RmlD_sub_bind" amino acids 299 to 429 (131 residues), 31 bits, see alignment E=4.3e-11 PF02719: Polysacc_synt_2" amino acids 300 to 607 (308 residues), 407.2 bits, see alignment E=1.1e-125 PF01370: Epimerase" amino acids 300 to 527 (228 residues), 59.3 bits, see alignment E=1.2e-19 PF01073: 3Beta_HSD" amino acids 301 to 433 (133 residues), 28 bits, see alignment E=3.3e-10 PF16363: GDP_Man_Dehyd" amino acids 301 to 428 (128 residues), 41.7 bits, see alignment E=3.1e-14

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a1575)

MetaCyc: 76% identical to UDP-N-acetylglucosamine 4,6-dehydratase (configuration-retaining) (Pseudomonas aeruginosa)
RXN-13252 [EC: 4.2.1.135]

Predicted SEED Role

"nucleotide sugar epimerase/dehydratase WbpM"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.135

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (664 amino acids)

>PFR28_00932 UDP-N-acetyl-alpha-D-glucosamine C6 dehydratase (Pseudomonas sp. RS175)
MNKLRTALLGLPRRHKRAIQLAMDVILVWLALWLAFVVRLGVDALATPIETHLWLFSSAP
LIAIPIFIRFGMYRAVMRYFGNDALITICKAVSLSALLLALVVYWYSNHKTVVPRSIIFN
YWWLSLIMIGGLRLMMRQYFLGDWFAAAQHVPFTSRDDGLPKVAIYGAGAAGNQLVAALR
MGRVMRPVAFIDDDSSIADRIIAGLQVYEPKHIQKMIDATGAQEILLAIPSSSRGRRREI
LTLLEGFPLHVRSVPGFMDLASGRVKVDDIQEVDIADLLGRDAVPAQPDLLEHCITGQSV
LVTGAGGSIGSELCRQILALKPTTLLLYEHSEFNLYSILSELEPRITRESLSVRLLPILG
SVRDQGKLLDVMKTWNVDTVYHAAAYKHVPMVEHNIAEGVLNNVMGTLNTAQAALQAGVS
NFVLISTDKAVRPTNVMGSTKRLAELTLQALSRELAPVLFGDKANVSRVNKTRFTMVRFG
NVLGSSGSVIPLFHKQIKSGGPLTVTHPKITRYFMTIPEAAQLVIQAGSMGLGGDVFVLD
MGEPVRIVQLAEKMIHLSGLSIRSEKNPHGDISIEFTGLRPGEKLYEELLIGDNVVATQH
PMIMSANEDYLPWDVLKARLAELLAAIEQDDYTRVRQLLRDTVSGYAPDGEIVDWIYQQR
RLEP