Protein Info for PFR28_00926 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 282 to 309 (28 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details PF14667: Polysacc_synt_C" amino acids 323 to 404 (82 residues), 38.3 bits, see alignment E=7.4e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>PFR28_00926 hypothetical protein (Pseudomonas sp. RS175)
MAAIYKTLGLVFGYSSVLLTSKGLTLLVSYLVAFSVDNTEFGYFSLAQALFITAVALLGF
NSSAAYVRYFYSEGVSAVYNALKRVYFIFFALSVFLGLLLYAIFSEHPHFVWFALLPLSG
FLGAHIASFNAIYRCSNNLQGYAFAELGRPLLVFLVLAFFLWNKFEFSVVAVYLIVLCFS
LFLVVSCSVFHLRSKLFNVSQSSLEEKGVVMYLFPLVIVQVMALLNNVGDRYVLSAFVTM
DELGKYGKAYLIGSAVGMIIDSFSLLWAPYVVRRVKAFKTSLYPMVTLIFFGATCLSLLL
LVGAGFVFYYKISFFSFDHLFWVMAIVVLSAFMVRVGYQIFVPVLSAHDLTGIVAKLSFV
GAGGGMIANFALIPFLGGIGAAIATWISFFIFSILSLWAVREKIISV