Protein Info for PFR28_00918 in Pseudomonas sp. RS175

Annotation: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03589: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
  • amino acids 1 to 321 (321 residues), 547.4 bits, E=4.5e-169
• PF04321: RmlD_sub_bind
  • amino acids 6 to 194 (189 residues), 31.2 bits, E=5.4e-11
• PF01370: Epimerase
  • amino acids 7 to 223 (217 residues), 83.5 bits, E=7.1e-27
• PF05368: NmrA
  • amino acids 7 to 122 (116 residues), 31.8 bits, E=4.4e-11
• PF02719: Polysacc_synt_2
  • amino acids 7 to 278 (272 residues), 339.1 bits, E=9.7e-105
• PF01073: 3Beta_HSD
  • amino acids 8 to 129 (122 residues), 62.9 bits, E=1.2e-20
• PF16363: GDP_Man_Dehyd
  • amino acids 8 to 128 (121 residues), 52.2 bits, E=3.1e-17
• PF13460: NAD_binding_10
  • amino acids 11 to 130 (120 residues), 41.4 bits, E=6.5e-14

Best Hits

Swiss-Prot: 62% identical to PSEB_CAMJE: UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (pseB) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: None (inferred from 95% identity to pmk:MDS_1966)

MetaCyc: 60% identical to UDP-N-acetylglucosamine 4,6-dehydratase subunit (Helicobacter pylori 26695)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

• CMP-pseudaminate biosynthesis (5/6 steps found)
• UDP-N-acetyl-β-L-fucosamine biosynthesis (1/4 steps found)
• UDP-N-acetyl-β-L-quinovosamine biosynthesis (1/4 steps found)
• CMP-diacetamido-8-epilegionaminic acid biosynthesis (1/7 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (9/24 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Protein Sequence (332 amino acids)

>PFR28_00918 UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (Pseudomonas sp. RS175)
MFTNQTILVTGGTGSFGNTFVPMTLAKYNPKKIIIFSRDEMKQWDMAKKFEGDPRVRFFI
GDVRDKDRLYRALDGVDYVVHAAATKIVPTAEYNPFECVKTNINGAMNLIDACIDKGVKR
VVALSTDKASSPINLYGATKLASDKLFVSGNSYAGGHDTRFAVVRYGNVMGSRGSVIPFF
MSIKDKGVLPITDDRMTRFMISLEEGVELVWHAFEDMEGGEIYVKKIPSMKVTDLARVVA
PEARQEIIGIRPGEKLHEQMISAEDSYYTYDYPEHYKILPVINNWSTCAKRIKNGKKVPE
GFVYSSDNNVEWMSDEDLQVWIDSNREKIGSI