Protein Info for PFR28_00906 in Pseudomonas sp. RS175

Annotation: Phosphoserine aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00266: Aminotran_5
  • amino acids 30 to 373 (344 residues), 153.4 bits, E=4.3e-49
• TIGR01364: phosphoserine transaminase
  • amino acids 30 to 384 (355 residues), 535.2 bits, E=3.2e-165

Best Hits

Swiss-Prot: 92% identical to SERC_PSEU2: Phosphoserine aminotransferase (serC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00831, phosphoserine aminotransferase [EC: 2.6.1.52] (inferred from 98% identity to pba:PSEBR_a1549)

MetaCyc: 51% identical to phosphoserine aminotransferase (Arabidopsis thaliana col)
Phosphoserine transaminase. [EC: 2.6.1.52]

Predicted SEED Role

"Phosphoserine aminotransferase (EC 2.6.1.52)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 2.6.1.52)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.52

Protein Sequence (385 amino acids)

>PFR28_00906 Phosphoserine aminotransferase (Pseudomonas sp. RS175)
MQSTGTIPCRPKDLSDHQIRARLDVSKRAYNFCAGPAALPEAVLKRAQGELLDWHGKGLS
VMEMSHRSDEFVSIATKAEQDLRDLLNIPSNYKVLFLQGGASQQFAQVPLNLLPESGKAD
YIDTGIWSQKAIEEASRYGHVNVAASAKPYDYFAIPGQNEWNLSKDAAYVHYAPNETIGG
LEFNWIPETGDVPLVADMSSDILSRPVDISRFGMIYAGAQKNIGPSGILVSIIREDLLGR
ARALCPTMLDYKVAADNGSMYNTPPTLAWYLSGLVFEWLKEQGGVEAIGKLNEVKQRTLY
DFIDASDLYSNPINKTDRSWMNVPFRLADDRLDKPFLAGAEERGLLNLKGHRSVGGMRAS
IYNAVDIHAVNALVAYMAEFEKEHG