Protein Info for PFR28_00844 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03500: flagellar biosynthetic protein FliO
  • amino acids 35 to 103 (69 residues), 74 bits, E=4e-25
• PF04347: FliO
  • amino acids 47 to 127 (81 residues), 74.9 bits, E=2.2e-25

Best Hits

Swiss-Prot: 64% identical to FLIO_PSEAE: Flagellar protein FliO (fliO) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02418, flagellar protein FliO/FliZ (inferred from 91% identity to pba:PSEBR_a1490)

Predicted SEED Role

"Flagellar biosynthesis protein FliQ" in subsystem Flagellum

Protein Sequence (135 amino acids)

>PFR28_00844 hypothetical protein (Pseudomonas sp. RS175)
MLPFSVLAAEPAATTTATASGSSMAGQLAQLVLGLLLVLGLIFFLAWLLRRVQQAGPAGK
GQVIDIVGSRALGPRDRLVLVQVGNEQILLGLSPGTITALHVLKEPVQVPSTEQATPEFA
QRLMELLGKDQKDKK