Protein Info for PFR28_00831 in Pseudomonas sp. RS175

Annotation: Flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 21 to 107 (87 residues), 91.6 bits, E=2.1e-30
• PF02049: FliE
  • amino acids 24 to 108 (85 residues), 107.9 bits, E=1.1e-35

Best Hits

Swiss-Prot: 92% identical to FLIE_PSEF5: Flagellar hook-basal body complex protein FliE (fliE) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 99% identity to pba:PSEBR_a1477)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Protein Sequence (108 amino acids)

>PFR28_00831 Flagellar hook-basal body complex protein FliE (Pseudomonas sp. RS175)
MSQGIEFNRLMLDMRAMQMDAMAQPKSVAVPQVGGSSFSDMLGQAVNKVNDTQQASSQLA
SAFEIGKSGVDLTDVMISSQKASVSFQALTQVRNKLVQAYQDIMQMPV