Protein Info for PFR28_00826 in Pseudomonas sp. RS175

Annotation: Flagellar secretion chaperone FliS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF02561: FliS" amino acids 8 to 124 (117 residues), 126.6 bits, see alignment E=3e-41 TIGR00208: flagellar protein FliS" amino acids 9 to 123 (115 residues), 92.3 bits, see alignment E=1.2e-30

Best Hits

Swiss-Prot: 58% identical to FLISB_PSEAE: Flagellar secretion chaperone FliSB (fliS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02422, flagellar protein FliS (inferred from 90% identity to pba:PSEBR_a1472)

Predicted SEED Role

"Flagellar biosynthesis protein FliS" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>PFR28_00826 Flagellar secretion chaperone FliS (Pseudomonas sp. RS175)
MNPMLALRQYQKIGAQAQTSEASPHRLVQMLMEGGLDRIAQAKGAMERKDIANKGVFISK
AIGIIGGLREGLDLENQAESVAELDALYAYMMKRLAEANAKTDPKILDEVADLLRTVKEG
WDGIAPQGPQF