Protein Info for PFR28_00825 in Pseudomonas sp. RS175

Annotation: B-type flagellar hook-associated protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF02465: FliD_N" amino acids 13 to 111 (99 residues), 68.7 bits, see alignment E=8.2e-23 PF07196: Flagellin_IN" amino acids 131 to 185 (55 residues), 38.6 bits, see alignment 1.5e-13 PF07195: FliD_C" amino acids 223 to 458 (236 residues), 171.4 bits, see alignment E=3.4e-54

Best Hits

KEGG orthology group: K02407, flagellar hook-associated protein 2 (inferred from 67% identity to pba:PSEBR_a1471)

Predicted SEED Role

"Flagellar hook-associated protein FliD" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>PFR28_00825 B-type flagellar hook-associated protein 2 (Pseudomonas sp. RS175)
MASPILPGLGLGSGLDTTAIVKALVDSDKAAKQGQIDRATKTNAANISGIGTLKSLLATF
QSTLDSLGSTTTPQFTGVSATSANNTALTVAATNSAVSGTYSINVTQLATSSKVATAAFA
GGASSQVGAGTLTISQAGKDYTLDVPADGTLQSVRDAINSKYSSSGLTANIVTDNFGSRL
VVGSTKTGAGSDISLSGIASLAADGSTLMGTPSATSSGSIGLAKDAVFTVDGLSMTSPTN
KLSNVISGLDMTLLVANSGPTTVTVATNTDGLKASIQKFVDAYNAVAKAVTSLTKPSTDA
DGNSVPAALTGDSLPRSLLAAIRAPLSETGAGDKLTVLSQLGITTNQTTGALDFNSTKFT
AALNEKQLGGEIQTLFTGENGLIERMKDALAPYTVNKADPNDPKKTIDSILTARSKNLDV
LKAKLSADQAALDRRIETLTAVLTKKYNDMDTLVGKLKATASNITSMFEALTAQQKNS