Protein Info for PFR28_00808 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10135: Rod-binding
  • amino acids 53 to 104 (52 residues), 60.6 bits, 1.6e-20
• TIGR02541: flagellar rod assembly protein/muramidase FlgJ
  • amino acids 268 to 423 (156 residues), 204.3 bits, E=1.9e-64
• PF01832: Glucosaminidase
  • amino acids 286 to 423 (138 residues), 124 bits, E=6e-40

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 91% identity to pba:PSEBR_a1463)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (438 amino acids)

>PFR28_00808 hypothetical protein (Pseudomonas sp. RS175)
MDMRKGALISGDSASYSDLNRLNQLKVGDKNSDGNLRKVAQEFESLFIGEMLKSMRSATE
VLGKDNPMNTPEAKQYQEMYDQQLAVSMSREGGGIGLADVLLRQMSKNKSLASGEAATLS
AAKQQEAQDQVAKAPVPTPVAAGTLSDGPLSRTSGQRPLWASRAVRAPQEAGEGGHRNDM
ELLNQRRLALPPKLADRLLAGLVPSAVANGKVNADAPAMNILPDRAVTGVKPASGELANG
DWLATLKAAESKGDMQIYGRAVAQPPLAPARKAFRDADEFVNAMLPMAKEAADRIGVDPR
YLVAQAALETGWGKSVMRQPDGSSSHNLFGIKASKNWTGDSARAITSEFRNGEMVKETAE
FRSYASYRDSFHDLVNLLQSNSRYQDVLKSADNPEQFVRELQKAGYATDPNYASKISNIA
RQMTSYQNYASAGATTTL