Protein Info for PFR28_00807 in Pseudomonas sp. RS175

Annotation: Flagellar P-ring protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF02119: FlgI" amino acids 23 to 367 (345 residues), 488.5 bits, see alignment E=4.8e-151

Best Hits

Swiss-Prot: 96% identical to FLGI_PSEF5: Flagellar P-ring protein (flgI) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02394, flagellar P-ring protein precursor FlgI (inferred from 98% identity to pba:PSEBR_a1462)

Predicted SEED Role

"Flagellar P-ring protein FlgI" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>PFR28_00807 Flagellar P-ring protein (Pseudomonas sp. RS175)
MNLKQLLLGALVMSAAFSVQAERLKDIASISGVRSNQLIGYGLVVGLNGTGDQTTQTPFT
LQTFNNMLSQFGIKVPAGSGNVQLKNVAAVSVSADLPAFAKPGQQVDITVSSIGNSKSLR
GGTLLLTPLKGIDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSAGRIPGGASVERAVP
SGFNQGNSLTLNLNRSDFTTAKRIVDKINDMLGPGVAQAIDGGSIRVTAPLDPSQRVDYL
SILENLEVDPGQAVAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGPL
SNGQTAVVPRSRVNAEQEAKPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAGA
LQADLIVI