Protein Info for PFR28_00775 in Pseudomonas sp. RS175

Annotation: Osmoregulated proline transporter OpuE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 117 to 141 (25 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 308 to 333 (26 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details amino acids 434 to 452 (19 residues), see Phobius details PF00474: SSF" amino acids 32 to 415 (384 residues), 134.1 bits, see alignment E=3.1e-43

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a1423)

Predicted SEED Role

"sodium-solute symporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>PFR28_00775 Osmoregulated proline transporter OpuE (Pseudomonas sp. RS175)
MALDLIVVLIYAAGMIALGWYGMRRARTRDDYLVAGRNLGPGFYLGTMAATVLGGASTIG
TVRLGYVHGISGFWLCGAIGLGIVGLSLFLAKPLLKLKIYTVTQVLERRYNPAARHASAV
IMLVYALMIGATSTIAIGTVMQVLFGLPFWASILVGGGVVVLYSTIGGMWSLTLTDIVQF
LIMTVGLVFLLMPMSIVDAGGWDAMVAKLPASYFDFTAIGWDTIVTYFLIYFFGIFIGQD
IWQRVFTARSEGVAKVAGTAAGLYCVLYGLAGALIGMAAKVLLPDLENVNNAFASVVQTS
LPNGIRGLVVAAALAALMSTAAAGLLAASTTVVQDLLPRLRQGREGGSADVHENRIATLL
MGVVVLGIALVVSDVISALTLAYNLLVGGMLIPLIGAIYWKRATTAGAITSMSLGFVTAL
FFMFKDGLDANTPIYYSLGVALVSFVLVSLLSPRPKVVAKAV