Protein Info for PFR28_00737 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details PF00892: EamA" amino acids 9 to 135 (127 residues), 56.4 bits, see alignment E=1.9e-19 amino acids 149 to 289 (141 residues), 51 bits, see alignment E=8.8e-18

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a1393)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>PFR28_00737 hypothetical protein (Pseudomonas sp. RS175)
MNLVDLLRLLSLAAIWGASFLFMRIIAPVIGTIPTAFFRVSIAFVGLLVILALMRIDWNF
RGKLKVVMGLGLINSGIPATFYSLAAQVLPAGYSAIFNATTPLMGVLIGGLFFSEQLTVA
KVSGVFLGLLGVGILTGAGPVAFDLQLLMGALACLMATTCYGFAGFLTRRWLDHQGGLDS
RLSALGSMFGATVFLLPLFGYSVISQPPASWGGWSVWLSLLGLGLVCTALAYILYFRLLS
AIGPVKSMTVTFLIPPFGVLWGALLLDEPLGMAHLYGGVLIAAALWLVLKPAAQTSVQVP
QRR