Protein Info for PFR28_00727 in Pseudomonas sp. RS175

Annotation: Putative metabolite transport protein YjhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 40 to 63 (24 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 230 to 259 (30 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 309 to 326 (18 residues), see Phobius details amino acids 332 to 358 (27 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 289 (252 residues), 126.3 bits, see alignment E=1.4e-40 amino acids 284 to 422 (139 residues), 44.8 bits, see alignment E=8.2e-16 PF00083: Sugar_tr" amino acids 64 to 221 (158 residues), 76.6 bits, see alignment E=2e-25

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a1383)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>PFR28_00727 Putative metabolite transport protein YjhB (Pseudomonas sp. RS175)
MSAPDTLGVPQPQARSGPFDWYRNINQQERRTFWSCKIGYALDGMDTQMLSFVVPTLIAM
WGITTGQAGLIHTSTLIASAIGGWVAGILSDRIGRVRTLQLTVLWFAFFTFLCGFAQNYE
QLLIARTLMGFGFGGEWTAGAVLMGEVIRAKDRGKAVGMVQSGWALGWGMTAILYALLFS
VLPPEDAWRALFILGIVPAVFVIFVRRLVKDPEVYNQTKARLTPQNPAKFYEIFAPGILF
TTIRASLLTTGALGGYYAITSWLPTFLKNERGLSVLSTGGYLAMVIVGSYIGYVISAYLS
DILGRKKNFVLYAIGSFTIVLLYTQVPVSNDVMLWLGFPLGFFASGMFSGMGSFLTELFP
TRIRGSGQGFCYNIGRAVAALFPLLIGLLSQKVPLSVGIGAFAAVSYGVVILAALSLPET
QGKQLEAE