Protein Info for PFR28_00693 in Pseudomonas sp. RS175

Annotation: Periplasmic serine endoprotease DegP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02037: peptidase Do" amino acids 32 to 471 (440 residues), 526.7 bits, see alignment E=2.4e-162 PF00089: Trypsin" amino acids 96 to 253 (158 residues), 65.9 bits, see alignment E=1.2e-21 PF13365: Trypsin_2" amino acids 99 to 232 (134 residues), 136.1 bits, see alignment E=3.8e-43 PF00595: PDZ" amino acids 266 to 327 (62 residues), 37.9 bits, see alignment E=4.8e-13 amino acids 381 to 458 (78 residues), 36 bits, see alignment E=1.9e-12 PF13180: PDZ_2" amino acids 273 to 362 (90 residues), 60.5 bits, see alignment E=3.9e-20 amino acids 387 to 467 (81 residues), 36.1 bits, see alignment E=1.7e-12 PF17820: PDZ_6" amino acids 298 to 350 (53 residues), 44.2 bits, see alignment 3.4e-15 amino acids 410 to 462 (53 residues), 37.6 bits, see alignment 3.8e-13

Best Hits

Swiss-Prot: 90% identical to DEGPL_PSEF5: Probable periplasmic serine endoprotease DegP-like (mucD) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a1341)

Predicted SEED Role

"HtrA protease/chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>PFR28_00693 Periplasmic serine endoprotease DegP (Pseudomonas sp. RS175)
MSIPRLKTYLSIFATVLVLGQGVPAMAADLPDFTHLVEEASPAVVNISTTQKLPDRRVSD
PQMPDLEGLPPMLREFFERGMPQPRSPGGGRQREAQSLGSGFIISPDGYILTNNHVIADA
DEILVRLADRSELKAKLVGTDPRSDVALLKIEGKDLPVLKLGKSQNLKAGQWVVAIGSPF
GFDHTVTQGIVSAIGRSLPNENYVPFIQTDVPINPGNSGGPLFNLDGEVVGINSQIYTRS
GGFMGVSFAIPIDVAMDVSNQLKSEGKVSRGWLGVVIQEVNKDLAESFGLEKPAGALVAQ
IQEGGPAAKGGLQVGDVILKLNDQPIIMSADLPHLVGALKAGAKANLEVIREGKRKNVEL
TVGAIPEEGAELESQPKSGIERSSNRLGVAVVELTAEQKRTLELQGGVVIKEVQDGPAAL
IGLQPGDIITHLNNQAISSAKQFTDIANALPKNRSVSMRVLRQGRASFITFKLAE