Protein Info for PFR28_00678 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 148 to 165 (18 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details TIGR03082: membrane protein AbrB duplication" amino acids 9 to 163 (155 residues), 125 bits, see alignment E=1.2e-40 amino acids 182 to 338 (157 residues), 141.3 bits, see alignment E=1.2e-45 PF05145: AbrB" amino acids 32 to 338 (307 residues), 292.2 bits, see alignment E=2.1e-91

Best Hits

KEGG orthology group: K07120, (no description) (inferred from 96% identity to pba:PSEBR_a1328)

Predicted SEED Role

"Ammonia monooxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>PFR28_00678 hypothetical protein (Pseudomonas sp. RS175)
MSEATFRQWWGTPLVGLAGGYLASLIGWPLPWMVGSLLAIILVRCLTPWQLAEIPGGRKC
GQWVVGIGIGLHFTPVVMEQVLSHFGLIFFGALITSVSSVVSVWLMRRTGEDRATAFFSS
MPGGSGEMVNLGARNGADLSRVAAGQSLRVLVVVLCVPAAFKYLLGQGAPVQHATTVDWL
WLAILFPAGALLAWIWERLRQPNPWLFGPLLVSAVVSVAWDLHISLPHGGSQIGQWLIGS
GLGCHFNRQFFRRAPSFMGRTLVGTVLTMLIATLAALGLSTLTHLDLRSLTLGMMPGGIA
EMSLTAETLQLSVPLVTALQVMRLLFVLFLAEPLFRYWMRKPASS