Protein Info for PFR28_00638 in Pseudomonas sp. RS175

Annotation: Acyl carrier protein phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF04336: ACP_PD" amino acids 81 to 183 (103 residues), 110.7 bits, see alignment E=2.4e-36

Best Hits

Swiss-Prot: 36% identical to ACPH_ECO27: Acyl carrier protein phosphodiesterase (acpH) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: None (inferred from 92% identity to pba:PSEBR_a1284)

MetaCyc: 37% identical to acyl carrier protein phosphodiesterase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] phosphodiesterase. [EC: 3.1.4.14]

Predicted SEED Role

"Acyl carrier protein phosphodiesterase (EC 3.1.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 3.1.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>PFR28_00638 Acyl carrier protein phosphodiesterase (Pseudomonas sp. RS175)
MNYLAHLHLGGPGREQLLGSLYGDFVKGPLQGLYDPRIEAGIALHRRIDHYTDRHPLVDI
ALSRFSTVRRRYAGIVLDVFFDHCLARDWALYGEGPLVDFTSRVYQVLSTEPQLPGRLAQ
IAPYMAADDWLGSYQEFEVLGQVLRGISRRLSRPEELAGAMKELIELYEPLSEDFQLFYP
QLQDFVQNQAAPRI