Protein Info for PFR28_00605 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 153 to 179 (27 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 248 to 409 (162 residues), 96.1 bits, see alignment E=9.2e-32 PF00990: GGDEF" amino acids 250 to 407 (158 residues), 120.7 bits, see alignment E=5.3e-39 PF00563: EAL" amino acids 427 to 662 (236 residues), 261.2 bits, see alignment E=8.4e-82

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a1250)

Predicted SEED Role

"GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (683 amino acids)

>PFR28_00605 hypothetical protein (Pseudomonas sp. RS175)
MKLELKNSLSVKLLRVVLISALIVGVVLSCAQIVFDAYKTNQAVSSDAQRILDMFRDPST
QAVYSLDREMGMQVIEGLFQDRAVRMASIGHPRETMLAEKSRPLQESESRWLTDLILDKE
RTFTTQLVGRGPYSEYYGDLSITLDTASYGHSFIVSSVIIFISGMLRALAMGLVLYLVYH
WMLTKPLSRIIEHLTEINPDRPSEHQIPQLRGHEQNELGLWINTANQLLASIERNTHLRH
EAENSLLRMAQYDFLTGLPNRQQLQQQLDKILVDAGRLQRRVAVLCVGLDDFKGINEQFS
YQTGDQLLLALADRLRAHSGRLGALARLGGDQFALVQADIEQPYEAAELAQSILDDLEAP
FVLDDHEIRLRATIGITLFPEDGGSTEKLLQKAEQTMTLAKTRSRNRYQFYIASVDSEMR
RRRELEKDLREALIRDQFTLVYQPQISYRDLRVVGTEALIRWHHPEHGFVPPDLFIPLAE
QNGTIIAIGEWVLDQACKQLREWHDQGFIELRMAVNLSTVQLHHAELPRVVNNLLQRYRL
PPRSLELEVTETGLMEDITTAAQHLLSLRRSGALIAIDDFGTGYSSLSYLKSLPLDKIKI
DKSFVQDLLEDEDDATIVRAIIQLGKSLGMQVIAEGVETVEQEAYIISEGCHEGQGYYYS
KPLPARELGAYLKQAQRSKALTL